SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016092 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016092
Domain Number 1 Region: 346-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.43e-26
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 573-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 461-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 517-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 615-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.7e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 24-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-20
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 8 Region: 252-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-16
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 9 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000366
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 10 Region: 192-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000164
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 11 Region: 101-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000108
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016092   Gene: ENSTTRG00000016975   Transcript: ENSTTRT00000016975
Sequence length 676
Comment pep:novel scaffold:turTru1:scaffold_112842:21041:33727:1 gene:ENSTTRG00000016975 transcript:ENSTTRT00000016975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAISRSSPLCPPSPMATAALRDPPEVGVTFEDIALYFSWEEWKLLDEAQRRLYHDVMLEN
FALISSLGVWSGEENVEASFEQNVSVVMSQVRTSKEPSSSQKTHPCEMCGPVLRDIFHLT
EQQGTQHSQKLFKRRACAKGFYFSADTQQHQEQHMQEKPFIIGVDRASFVKSSNFHVSGE
AFTCKKVAEDFLATSGHLNQQAIHTGEKPNTVTHAWKLYKAKSHCTRGECKKAFSPKHTL
VQAQSVYTERQCFMCSECGKTFKYKSSFVVHQRIHTGDRLYDCGDCGKSFRGSSALIQHR
RIHTGARQYKCSKCGKSFSQEFVFIYQQTVHTGEMSYECTERRKPFRRKSDLIEHWRVHT
GERPYECSECGKSFTSSSALRYHQRVHTGEKPYKCGECGKSFRKVFHLIIHRRVHTGERP
YECSECGKSFSHKSYLSQHQRVHTGERPYECSECGKSFRKSFTNGPILIRHRRVHTGERP
YECNECGKSFTQRNHLNIHQRVHTGERPYECIECGKSFTSGSALRYHQKIHIGERPYECS
ECEKSFTSSSALRCHQRVHTGERPFDCSECGKSFRDSSQLNQHQRVHTGEKPYECSDCGR
SFSQNSYLSKHRRVHTGERPYECSECEKSFTHNSGLIYHQRVHTGEKPYDCSECGKSFSR
KSNLSQHQRVHTGERP
Download sequence
Identical sequences ENSTTRP00000016092 ENSTTRP00000016092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]