SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016184 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016184
Domain Number 1 Region: 21-139
Classification Level Classification E-value
Superfamily Lysozyme-like 3.44e-41
Family C-type lysozyme 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016184   Gene: ENSTTRG00000017071   Transcript: ENSTTRT00000017071
Sequence length 140
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2519:29946:33578:-1 gene:ENSTTRG00000017071 transcript:ENSTTRT00000017071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSFVSLLLVGILFHAVQADQLTKCELFQRLDLHGYGGVTLPEWVCTVFHTSGCDTQTIV
NNNDSTEYGLFQINNKIWCRDNQIPHSRDICGISCDKFLDDDLTDDIMCVKKILDNVINY
WLAHKALCFEKLDQWRCEKW
Download sequence
Identical sequences ENSTTRP00000016184 ENSTTRP00000016184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]