SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016407 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016407
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.12e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 142-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.02e-22
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 236-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 194-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.49e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016407   Gene: ENSTTRG00000017312   Transcript: ENSTTRT00000017312
Sequence length 288
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1056:7979:19824:-1 gene:ENSTTRG00000017312 transcript:ENSTTRT00000017312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHDLVMFRDVTVDFSQEEWECLNSNQRNLYRDVILENYSNLVSLGGCSVSKPDVITLLE
QGKEPWMVVRDEKRRRSLDLESRYGTKKLFEVKDVCEMNVFQWEIMERIRSCGLEEQEGP
QEAYFRQVKKTTSEKMPKNKKRTSLTLYQRIHTREKPYECGDCGKAFRVRQQLTFHQRIH
TGEKPYECKECGKAFRQCAHLSRHQRIHASDKLLECKRCGKIFTCGADLRVHQRIHVGEK
PYDCKECGKAFRVRGQLNLHQRIHTGEKPYECKECGKTFRQYAHLTRH
Download sequence
Identical sequences ENSTTRP00000016407 ENSTTRP00000016407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]