SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|209554512|ref|YP_002284817.1| from Ureaplasma urealyticum serovar 10 str. ATCC 33699

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209554512|ref|YP_002284817.1|
Domain Number 1 Region: 14-96
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 3.14e-23
Family GIY-YIG endonuclease 0.0072
Further Details:      
 
Domain Number 2 Region: 95-150
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000617
Family Glycosyl hydrolase family 7 catalytic core 0.014
Further Details:      
 
Domain Number 3 Region: 513-568
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000197
Family Excinuclease UvrC C-terminal domain 0.034
Further Details:      
 
Weak hits

Sequence:  gi|209554512|ref|YP_002284817.1|
Domain Number - Region: 180-227
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.00314
Family C-terminal UvrC-binding domain of UvrB 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|209554512|ref|YP_002284817.1|
Sequence length 584
Comment excinuclease ABC subunit C [Ureaplasma urealyticum serovar 10 str. ATCC 33699]
Sequence
MNDLLKTKLKLIPHKPGCYLWKDEFDQIIYIGKAKDLYNRTHSYFNGPKDNKTSKLVSNI
KDLEYIVVNNVNEALILENNLIKTHRPKYNILLKDGSNYPYIMITNEQYPRLKYVRTYDK
NKGIYFGPLADSTNKYQLFNLLNSIFPFNKCNHQPHQKCIYYDLHRCINQVQPQTYEKAI
AEVKEIFKGNLDHILAILENKEQHAVAKLDFENAQKYAEQQKALTYIINSGLVQLDNNES
FDVVGFYEKNNYLVIIIFNYVKGKLLNKSADTFAIYDHEINELITSFLMQYYSQNRISTK
IIVSLDDDNLLALSQRFKTKFINAQTKFHKQILKLAFDNAILYFDSNIKSVINKQNELDE
ALNQLKQILKLPDLSMIECFDNSNINLSLPIAGMIVYQNGKLNNKLNRKYNLMTTKNASD
YHFMIEVITRRYQRLVSQHQKLPNLIVVDGGKLQVNAALYALEQLQISIPLIGLKKDQKH
KTNAIVLANGDEIILDRKSVLYKFLANMQNDVHNYAISFLRNKHTKSIFNSLLNDVQGLG
KKRLNELLNYYDSINDLKSASDQELLQFLPKNVLVNLREKLNKI
Download sequence
Identical sequences B5ZBM7
WP_012560321.1.48701 565575.UUR10_0424 gi|209554512|ref|YP_002284817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]