SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|TGVEG_001870 from Toxoplasma gondii VEG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|TGVEG_001870
Domain Number 1 Region: 165-226
Classification Level Classification E-value
Superfamily PH domain-like 0.00000712
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gb|TGVEG_001870
Sequence length 229
Comment | organism=Toxoplasma_gondii_VEG | product=hypothetical protein | location=TGVEG_chrXII:5019817-5021710(+) | length=229
Sequence
MGNTMSCFDRWGKRAPDGPLLHIKAKTAGGGSDIIQAASTASTAAASTAPAPAAAGAAAS
PGAAAPVPERPMRRRQTYSLKAKKSDTEMSSMSELSDESESEPDNDAVSASDIRMKKVMQ
YRRALTKVVKLKTHLFSETVKVTCSKDGEEVQWFKGKSTAGAQDRKKPSGGFPVDKITSV
KSQADNTKVLVITVNNPQPTTYNFTFKSPGERESWQEQIQSLMKFMSMK
Download sequence
Identical sequences A0A125YY72 B6KHK6
gb|TGME49_049970 gi|211964993|gb|EEB00189.1| gi|237836063|ref|XP_002367329.1| XP_002367329.1.89292 gb|TGVEG_001870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]