SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|TGVEG_010650 from Toxoplasma gondii VEG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|TGVEG_010650
Domain Number 1 Region: 425-613
Classification Level Classification E-value
Superfamily Kelch motif 2.62e-27
Family Kelch motif 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gb|TGVEG_010650
Sequence length 643
Comment | organism=Toxoplasma_gondii_VEG | product=kelch motif domain-containing protein, putative | location=TGVEG_chrIV:1029493-1036287(+) | length=643
Sequence
MACDRLAAMLPSQRRGLCCRGRNALLFFALFCFAVCLLGHQGPSSVCFVVSASDGSAEGG
QGPSNVGGSDAQGGGFSFASLLSMAPNSETLQQILGDFSKQAAEFLKGNKTLEKLDIGPL
QDNLERITTLLGMKPDLRKIIVSNRRHLEVLYMPIYTFAQQRALERNPEADDSALSVVLQ
DPHMAKFVAKYVDLEPSRTMSTAPKQLDGFVQQIQDLRKYVLTDGPVVFSLISRLDAVVS
AFLQYTQTMFSSVARYISLTDRFAKNKRALFFFGKYTLPKLLEVFFIINSIEAQLLRRIQ
LLENPDDAKRLRFQLRGLVTKTDEAVASLYDLSKGCLIGCSASFQIEYASCVKSYEEGER
VEIAFRRFTSSPPHEGMTLPSSAAATGEPNGALPADALDASQYLQVIQDQVQEEQQQKRR
EPDMTWSQPETSGTPPCPRYGHASLVVGRQLIVCGGMHRVQLCPAERDALLEKVELKDWY
LMDLAVLDMVTFTWYRVRTHGNPPAPRFGHTMAALNGDLVVFGGWAGANAHYGMIAKHIH
HSQEEGQDDNQVHDLPQTLLSCFSTATMTWETCSSFGNAPKARYGHSCTQVGSKLIIFGG
WDTSIALNDVVVLCELKEEHFNDLSAFEADTTVAPDCPTGTGS
Download sequence
Identical sequences gb|TGVEG_010650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]