SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|TGVEG_028520 from Toxoplasma gondii VEG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|TGVEG_028520
Domain Number 1 Region: 146-242
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000301
Family PWWP domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gb|TGVEG_028520
Sequence length 1187
Comment | organism=Toxoplasma_gondii_VEG | product=conserved hypothetical protein | location=TGVEG_chrXII:6605016-6611875(-) | length=1187
Sequence
MPSKRIIEEEKKRLARSTHQASDAETTPRNRDKSRGKGKREREKEKRDGGKKEKRDGEKK
EKRDGEKKEKRDGEKKEKRDGENKEKRDGDSSRRRSPRREAKEERKTHGKKVATLPSLSK
PSAMLATDWSSLKCLSRVVGKRGEPLVWFKKSGSPWWPGLVCLPTDPCLNPPLEPRQSVV
RPHRVLVLSLGINTYYWAQPSNIRDFRLAYDEFAPMAKKLNKASRMALQTALEECAWKDS
PDWTSISTLITQPDRLSDDEDWLTEGEASSDDDVFVSAPAALPDAPAGQTPRRGRDGERR
PGETDERDGRDERKRVIRKEETRQQKPETAEAKKTEEKSSAQAARKSLQERIAELRKRSR
KQVSNSPKKEIGRESLKAKEPEKKRESSRSTSRSSQSTSRTSSQDKENDGNSRRSNSESS
CQQSGPQASSRSSSRSSCHSSSRSSSPSSSRSSSRSSARSSSRSSSPSSSRSAARSSSHS
SARSCSRSSARSSSRSSSPSSSRSSCSARSKKSGGSGEETPRKEDGVTRHSEELPTCDGG
GESEGEGKGSERSSSEREEAESEAGSESSRRDSVTSEEKGDSDEKETASEASVGSTLRAA
KSAGVEENASDGEKEEDMKSRSSSASRESSSSARESDSEEQQDDEGANSKASERGSSRSL
SRFSGDNKDEEKRDSSSRSSSQAPGQEAERAETISSGGNSGASSRRSSVSEGEQAGSDFR
GGSPEKAPEEDRKEDICVADSTEDAAVKKLSRSPSVEETPREAEGVRRGERKGKRQRGKD
AEKKSDRRPKGKREEKKSHSEKKTRREKRSEHEEEGRESHRADSRRIREKGRDIEKNRGR
KRSGEKKSENSRATHSSSATEAQKRQEKSTREDRRARRAPTLARVSQPVARLQASPPFFS
SVAAVLRAAARPIAVCAPRRLTADFAAVVGIAVHQPTGSAGAREEGRTRQRPPCAEALHP
LQLHLCSRRLQVRQQLQLLSPRGPPPPHGYADECMLVAKQSLDHSPRLAPEKRRVVARLL
FVLESRTFLFALPVGLLCLLAELREPQAVAVWPLAPRLGLQEPFAAADGLPLSARQRALR
LAAGVSAATTRAAQDACSVCLRGGADFLCVARPGDLGAYARNSLCAASVLFGLSWRANGP
KNGHKEEQRQRQTASLSAALQPVFSGASARFFVVKAFSLHALDGRGV
Download sequence
Identical sequences gb|TGVEG_028520 gi|211968146|gb|EEB03342.1| gi|237842369|ref|XP_002370482.1| gb|TGME49_077770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]