SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|Tc00.1047053509499.20 from Trypanosoma cruzi strain CL Brener

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|Tc00.1047053509499.20
Domain Number 1 Region: 29-318
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.44e-39
Family WD40-repeat 0.0012
Further Details:      
 
Weak hits

Sequence:  psu|Tc00.1047053509499.20
Domain Number - Region: 375-441
Classification Level Classification E-value
Superfamily SIS domain 0.01
Family mono-SIS domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|Tc00.1047053509499.20
Sequence length 482
Comment | organism=Trypanosoma_cruzi_CL_Brener_Esmeraldo-like | product=beta propeller protein, putative | location=TcChr22-S:118952-120400(+) | length=482
Sequence
MDQKLWSLPVKRVPVAQKVDRSVIWNNACLCYEQKLFGQVTCVRYNNTGTAVGCTSTNQL
TILRVPQTEGVITNEQREKKCFSLRFRDDDKMVLLSVNQRVIARSTQTAFERQFSGHLRE
VRDAIFLDRHNFVSASDDTTIRLWDIMNENELLISKTHTDYVRCLENYSPGCFFSGSYDH
NVNLWDTRVGFEHPIQSSGRSIGSPVEAMLHTHNNILTCSAGDQLILFDMRKGLSTMLLQ
ESHHTKAVVSLAFSKRNNVLLTGSLDQRVKIFSLEKGGLEPLAGKKFDAPVTAVTVHPNL
SEFAVGTAGGDLRIMRLGDALDQNEKEEEVELVEDELGGKDKNTQDDFLGTKLHDVRQQL
VSYQYNRAIKTALYSRSSDVIVSTLEELIRRGALHVALSGQNDRTIVRILRFSVNHVDSP
HFCESMMIVMDVIFEIYATCAGKSNFLHREMMIARRRLGSVLATLQRMEHTLSIMELIVN
DV
Download sequence
Identical sequences Q4CX86
XP_806738.1.87722 psu|Tc00.1047053509499.20 gi|71408701|ref|XP_806738.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]