SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|508607873|ref|YP_006993830.2| from Carnobacterium maltaromaticum LMA28

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|508607873|ref|YP_006993830.2|
Domain Number 1 Region: 6-125
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-36
Family BPHL domain 0.0000716
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|508607873|ref|YP_006993830.2|
Sequence length 125
Comment conserved hypothetical protein [Carnobacterium maltaromaticum LMA28]
Sequence
MGLFSGLINNASDANINDVRKKLADVLLPTEDIELAYKLVRDMVIFTEKRLIIIDKQGVT
GKKTSYKSYPYRSISRFTVETTGHFDLDAELHIFISSALEPAATLTFSKDRHIVEIQQAL
AKAVL
Download sequence
Identical sequences A0A0R2IGX9 A0A0R2K9K0 K8E6L9
gi|508607873|ref|YP_006993830.2| WP_010052755.1.1647 WP_010052755.1.23088 WP_010052755.1.23174 WP_010052755.1.47092 WP_010052755.1.4825 WP_010052755.1.82043 WP_010052755.1.85729 WP_010052755.1.92980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]