SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479317252|ref|YP_007857303.1| from Streptomyces sp. PAMC26508

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479317252|ref|YP_007857303.1|
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 3.87e-22
Family Tetracyclin repressor-like, C-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479317252|ref|YP_007857303.1|
Sequence length 138
Comment putative TetR-family transcriptional regulator [Streptomyces sp. PAMC26508]
Sequence
MALSFSVAQALSEDTVARAGARLWAERRSIDAAVPTPFDAWVPAVTRLLAEARIRDELAD
GIQPSETAATLVCAFFGVCALGDDVPGGRHWSDRLERWWSLVLCALQAHPDPDTLIAQAQ
MRTPARQEATTQLVRERE
Download sequence
Identical sequences M9TQS6
gi|479317252|ref|YP_007857303.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]