SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479317800|ref|YP_007857851.1| from Streptomyces sp. PAMC26508

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479317800|ref|YP_007857851.1|
Domain Number 1 Region: 5-359
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 3.27e-53
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479317800|ref|YP_007857851.1|
Sequence length 361
Comment hypothetical protein F750_0856 [Streptomyces sp. PAMC26508]
Sequence
MTDVLLTVGTRKGLFLGRRRGGQWEFGDPHFNAQAIYSIAIDTRGATPRLLVGGDSAHWG
PSVFHSDDLGASWVEPKQPAVRFPRFTDASLERVWQLHPAGPEAPDVVYAGTEPAALFRS
DDRGESFELVRPLWEHPTRSRWVPGGGGEGLHTILTDPRDARAVTVAVSTAGVFRTEDGG
ERWDPSNKGVSAVFLPDPDPEFGQCVHKVTRDAADPDRLYLQNHWGVFRSDDAGKRWKDI
GAGLPSDFGFAAAAHPHRADTCYVFPINADADRVPAGHRCRVYRTRDAGETWEPLTRGLP
DGDHYGTVLRDGLCTDDADPAGVYFGNRNGEVYASADDGDSWQQLLSHLPDVLCVRAAVI
G
Download sequence
Identical sequences M9TM89
gi|479317800|ref|YP_007857851.1| WP_015576087.1.34797 WP_015576087.1.83303 WP_015576087.1.8887 WP_015576087.1.98132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]