SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479317845|ref|YP_007857896.1| from Streptomyces sp. PAMC26508

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479317845|ref|YP_007857896.1|
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.7e-32
Family Ribosomal protein S14 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479317845|ref|YP_007857896.1|
Sequence length 101
Comment SSU ribosomal protein S14p [Streptomyces sp. PAMC26508]
Sequence
MAKKSKIAQNEKRRVTVARYAARRAELKEIMRNPRTKERERRSAAEELRRQPRDASATRV
RNRDAVDGRPRGHLRKFGLSRVRMREQAHAGLLPGVTKSSW
Download sequence
Identical sequences M9TME9
WP_015576126.1.83303 gi|479317845|ref|YP_007857896.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]