SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479318178|ref|YP_007858229.1| from Streptomyces sp. PAMC26508

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479318178|ref|YP_007858229.1|
Domain Number 1 Region: 6-270
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.4e-60
Family Decarboxylase 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479318178|ref|YP_007858229.1|
Sequence length 279
Comment orotidine 5'-phosphate decarboxylase [Streptomyces sp. PAMC26508]
Sequence
MTPEPFGARLRHAMDTRGPLCVGIDPHASLLGSWGLNDDVAGLERFTRTVVEALADRVAV
LKPQSAFFERFGSRGVAVLEKAVEEARAAGALVLMDAKRGDIGSTMGAYAATYLDKDSPL
FSDAVTVSPYLGFGSLRPAFDAAEVSGAGVFVLALTSNPEGAEVQRATSADGRSLAQLML
DHMAAENAGATPLGSVGAVVGATLGDTGADLSINGPLLAPGIGAQGATPADLPRVFGAAV
RNVVPSVSRGVLRHGPDVSGLREAAGRFADEVRTAVPES
Download sequence
Identical sequences M9TRX6
gi|479318178|ref|YP_007858229.1| WP_015576377.1.81163 WP_015576377.1.83303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]