SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479322111|ref|YP_007862162.1| from Streptomyces sp. PAMC26508

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479322111|ref|YP_007862162.1|
Domain Number 1 Region: 6-151
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-46
Family Ribonuclease PH domain 1-like 0.000000115
Further Details:      
 
Domain Number 2 Region: 321-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-41
Family Ribonuclease PH domain 1-like 0.000000271
Further Details:      
 
Domain Number 3 Region: 152-260
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.53e-29
Family Ribonuclease PH domain 2-like 0.00000119
Further Details:      
 
Domain Number 4 Region: 474-573
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.13e-23
Family Ribonuclease PH domain 2-like 0.00000874
Further Details:      
 
Domain Number 5 Region: 576-688
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.6e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Domain Number 6 Region: 264-344
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 8.11e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479322111|ref|YP_007862162.1|
Sequence length 737
Comment polyribonucleotide nucleotidyltransferase [Streptomyces sp. PAMC26508]
Sequence
MENETHYAEAVIDNGTFGTRTIRFETGRLAKQAAGSAVAYLDDDTMVLSATTASKRPKDQ
LDFFPLTVDVEERQYAAGKIPGSFFRREGRPSEDAILTCRLIDRPLRPSFKKGLRNEIQI
VETIMALNPDHLYDVVAINAASASTILAGLPFSGPIGATRVALIKGQWVAFPTHTELEDA
VFDMVVAGRVLEDGDVAIMMVEAEATEKTIQLVKDGAEAPTEEVVAAGLEAAKPFIKTLC
KAQSDLAAKAAKPTGEFPVFLDYQDDVLEALTKAVRTELAKALTIAGKQEREAELDRIKE
IAGEKLLPAFEGREKEISGAYRALTKKLVRERVIKDKVRIDGRGVTDIRTLAAEVEAIPR
VHGSALFERGETQILGVTTLNMLRMEQQLDTLSPVTRKRYMHNYNFPPYSVGETGRVGSP
KRREIGHGALAERAIVPVLPSREEFPYAIRQVSEALGSNGSTSMGSVCASTMSLLNAGVP
LKAAVAGIAMGLISQEIDGKTHYVALTDILGAEDAFGDMDFKVAGTKQFVTALQLDTKLD
GIPASVLAAALKQARDARLHILDVMNEAIDVPDEMSPNAPRIITVKIPVDKIGEVIGPKG
KMINQIQEDTGADITIEDDGTIYIGAQQGSQAEAARATINAIANPTMPEVGERYLGTVVK
TTTFGAFVSLMPGKDGLLHISQIRKLAGGKRVENVEDVLGVGAKVQVEIAEIDSRGKLSL
IPVIEGEEDEKKDDTDK
Download sequence
Identical sequences A0A285DJT5 E8W6C3 M9TWL9
gi|357410832|ref|YP_004922568.1| gi|479322111|ref|YP_007862162.1| WP_014153720.1.34797 WP_014153720.1.77427 WP_014153720.1.77540 WP_014153720.1.81163 WP_014153720.1.83303 WP_014153720.1.8887 WP_014153720.1.8937 WP_014153720.1.98132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]