SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000631 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000631
Domain Number 1 Region: 45-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000845
Family V set domains (antibody variable domain-like) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000631   Gene: ENSVPAG00000000687   Transcript: ENSVPAT00000000687
Sequence length 153
Comment pep:novel scaffold:vicPac1:scaffold_23139:753:4838:-1 gene:ENSVPAG00000000687 transcript:ENSVPAT00000000687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTQAVLTPGFQPGPGFSGDTSQGDRTMWLSPALLLLCLPGCLCMKSPSSVMGTMGGSLRV
WCQYEKAYKGYNKWCRGKYDTSRDVIVETKGEEKEERNGRVSIRDYADDLTFTVTMENLN
ANDAGSWCRIQRVWILDVLSYDPSVQVKVSVFP
Download sequence
Identical sequences ENSVPAP00000000631 ENSVPAP00000000631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]