SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000745 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000745
Domain Number 1 Region: 16-502
Classification Level Classification E-value
Superfamily ALDH-like 2.49e-143
Family ALDH-like 0.000000511
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000745   Gene: ENSVPAG00000000805   Transcript: ENSVPAT00000000805
Sequence length 519
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1670:235964:246206:-1 gene:ENSVPAG00000000805 transcript:ENSVPAT00000000805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSSGVYSRWHPASSFSSSSSVPTVKLFIDGKFVESKSDKWIDIHNPATNEVIGRVPHATK
AEMDAAVSSCKRAFPAWADTSILSRQQVLLRYQQLIKENLKEIARIITLEQGKTLADAEG
DVFRGLQVVEHACSVTSLMLGETMPSITKDMDLYSYRLPLGVCAGIAPFNFPAMIPLWMF
PVAMVCGNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHGQHEAVNFICDHPDIKA
ISFVGSNQAGEYIFERGSRHGKRVQANMGAKNHGVVMPDANKENTLNQLVGAAFGAAGQR
CMALSTVILVGESKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLIDSGTK
EGASILLDGRNIKVKGYENGNFVGPTIISNVTPNMTCYKEEIFGPVLVVLETGTLDEAIK
IVNNNPYGNGTAIFTTNGATARKYSHLVDVGQVGVNVPIPVPLPMFSFTGSRSSFRGDTN
FYGKQGIQFYTQLKTITSQWKEEDATLSSPAVVMPTMGR
Download sequence
Identical sequences ENSVPAP00000000745 ENSVPAP00000000745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]