SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007618 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007618
Domain Number 1 Region: 187-428
Classification Level Classification E-value
Superfamily ALDH-like 2.62e-85
Family ALDH-like 0.00000555
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-40
Family ALDH-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007618   Gene: ENSVPAG00000008186   Transcript: ENSVPAT00000008186
Sequence length 430
Comment pep:novel genescaffold:vicPac1:GeneScaffold_2801:2069003:2088965:1 gene:ENSVPAG00000008186 transcript:ENSVPAT00000008186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERSSLLRKWYDLMIQNKDDLAKIITAESGKPLKEAQGEILYSANFLEWFSEEARRIYGDI
ICTPAKDRRALVLKQPLGVAAVITPWNFPSAMITRKVGAALAAGCSVVVKPAEDTPFSAL
ALAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXVLLHHAAKSVKRVSMELGGHAPFIVFDSANVDQAVAGAMASKFRNSGQTCVCSNR
FLVQRGIHDSFVKKFAEAIKTNLRVGNGFEERTTQGPLINEKAVEKVEKHVSDAVSKGAT
VVTGGKRHQVGKNFFEPTLLSNVTQDMLCSQEETFGPLAPVIKFDTEEEAVAIANATDVG
LAGYFYSQDPAQIWRVAERLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYL
ELKYVCLGGL
Download sequence
Identical sequences ENSVPAP00000007618 ENSVPAP00000007618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]