SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010366 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010366
Domain Number 1 Region: 34-474
Classification Level Classification E-value
Superfamily ALDH-like 8.51e-170
Family ALDH-like 0.000000000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010366   Gene: ENSVPAG00000011132   Transcript: ENSVPAT00000011130
Sequence length 479
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1261:86894:158369:-1 gene:ENSVPAG00000011132 transcript:ENSVPAT00000011130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFINXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADIDKAVQAARLAFSLGSVWRRMDA
SERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTLRYYAGWADKIHG
MTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKVAPALCCGNTVVIKPAEQTPLSA
LYMGALIKEAGFPPGVINILPGYGPTAGAAIASHVGIDKIAFTGSTEVGKLIQEAAGRSN
LKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRR
SVERAKRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFI
EPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALT
VSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
Download sequence
Identical sequences ENSVPAP00000010366 ENSVPAP00000010366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]