SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000438 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000438
Domain Number 1 Region: 6-132
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-20
Family Laminin G-like module 0.055
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000000438
Domain Number - Region: 282-305
Classification Level Classification E-value
Superfamily Notch domain 0.00183
Family Notch domain 0.0044
Further Details:      
 
Domain Number - Region: 1409-1439
Classification Level Classification E-value
Superfamily Notch domain 0.017
Family Notch domain 0.0067
Further Details:      
 
Domain Number - Region: 276-337,445-471
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0989
Family Growth factor receptor domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000438   Gene: ENSVPAG00000000466   Transcript: ENSVPAT00000000468
Sequence length 1472
Comment pep:novel genescaffold:vicPac1:GeneScaffold_990:234617:491579:1 gene:ENSVPAG00000000466 transcript:ENSVPAT00000000468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFDNCSHTVSDKGWALGIRSGKDVGRRDARFFFSLRTDRVTKATIVMGHSRYQPGKWTHV
AATYNGQRMVLYVDGTQVASSPDQSGPLHSPFMASCRSLLLGGDSSEDGHHFRGHLGTLV
LWSTALPQSHLQHSPQQPSEVEHLSTLILTASFEPLEEQWAPFRDEKYPRLEVLQDFEPE
PEILSPLQPPLCGQTACDNVELISQYNGHWPLRGEKVIRYQVVNICDDEGLNPTVSEEQI
HRQHEVLNEAFSRYNISWQLSVHQVHNSTLRHRVVLVNCEPSKIGNDHCDPECEHPLTGY
DGGDCRLQGRCYSWNRRDGLCHVECNNMLNDFDDGDCCDPEVADVHKTCFDPDSPRRAYM
SVKELKEALQLNSTHFLNVYFASSVREDLAGAATWPWDKEAISHLXXXXXXXXXXXXXXH
GNIMMREVGQVMGIYHVFKGVSERESCDDPCRKTVPSMDTGDLCADTAPTPKSKLCQDPE
PTNDTCGFTHFPGAPFSNYMSYTDDDCTDSFTPNQVARMHCYLDLVYQQWSQSRKPTPIP
LPPMVIGQTRKSLTVHWLPPISGVVYDRVPGSVCGACTEDGTFRQYVHTASSRRVCDSSG
YWTPEEAVGPPDVDQPCEPSLQAWSPELHLYHMNMTVPCPAEGCSLELLFQHPVQADTLT
LWVTYLSMDSSQALFDTEILLEHQESVHLGPLETFCDTPLTIKLHVDGKVLGAKVYTFDE
RMEIDAALLTSRPHSPLCSGCRPVRYQVLREPPFASGSSVVVTHLHRKFTDXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLGECDDGDLLSGDCACLEFCVGEP
SLCYIYEGDGICEPFEKETSIIDCGLYTPKGYLDQWAIQAYSSHEDKKKCPVSLVTGEPH
SMICTSHHPGLPEHRPLTGWFPCVTSQNRPQDEGRKQPKGSLEREDEVWLKVCFNRPGVA
TAIFIFLTSDGLVPGGHQRSTVTLHLTDVSGNSHSLGTYELSCQHNPLVINVTHPSHVLS
HRTASVLLNFSSPLVGISAVALRTSSHISPPAPNSCTPEHQGQNRQGQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKELLTCPGYWDRAV
SCMPLDCGPDPSLVNYATFCSEGTNFLKRCSISCVPPAKLQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPILCTKKGLW
TEEFKLCENLQGECPPPTSELNFVEYKCEQGYGIXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXSIVCTGRRQWHPDPLLIHCIQSCEPFQADGWCDTINNRAYCHYDGGDCC
SSTLSSKKVIPFAADCDLDECTCRDPKAEENQ
Download sequence
Identical sequences ENSVPAP00000000438 ENSVPAP00000000438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]