SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000900 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000900
Domain Number 1 Region: 2-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000201
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000900   Gene: ENSVPAG00000000976   Transcript: ENSVPAT00000000976
Sequence length 303
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1817:3896:5948:1 gene:ENSVPAG00000000976 transcript:ENSVPAT00000000976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSECSSQPCENGGTCVEGTNQYKCICPPGRTGSRCQHQAETXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
QCERNPCPMDSRPCRHMPKTISFHYLSLPSNLKTPITLFRMATASAPGRPGPNSLRFGIV
GGNSRGHFVMQRSDRQTGELILVQTLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFVSP
YDF
Download sequence
Identical sequences ENSVPAP00000000900 ENSVPAP00000000900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]