SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000974 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000974
Domain Number 1 Region: 209-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 4-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-18
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 171-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.25e-16
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 4 Region: 250-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000217
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000000974
Domain Number - Region: 125-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0167
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000974   Gene: ENSVPAG00000001058   Transcript: ENSVPAT00000001058
Sequence length 301
Comment pep:novel genescaffold:vicPac1:GeneScaffold_3362:4811:9251:1 gene:ENSVPAG00000001058 transcript:ENSVPAT00000001058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLETVTFGDVALDFTQEEWALLDTSQKKLFRDVMLENIHHLVSVXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXSESPLRQQEMIFMQQITMRSISPTTSMQVSHTQVDPVDSTD
LSDGFTDRSPSNQHLSIYLRRKHYVSKQSRTSLSEGSLGNGHDHTHTRGKLRECPLCGKV
FSNCFSLRRHEMTHTGEKPYQCHLCGSGFLQSSDLRKHNRTHTGEKPYRCQLCGKAFGQS
SYLKQHEKTHSGGKPYECRVCEKTFNQLSYLRKHEGVHRAEKRFACPQCGKAFGQSSGLS
Q
Download sequence
Identical sequences ENSVPAP00000000974 ENSVPAP00000000974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]