SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001210 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001210
Domain Number 1 Region: 635-830
Classification Level Classification E-value
Superfamily Sec7 domain 1.05e-72
Family Sec7 domain 0.0000017
Further Details:      
 
Domain Number 2 Region: 479-581,919-926,1137-1491,1649-1756
Classification Level Classification E-value
Superfamily ARM repeat 9.22e-24
Family Armadillo repeat 0.08
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000001210
Domain Number - Region: 57-226,453-575
Classification Level Classification E-value
Superfamily ARM repeat 0.000122
Family Exportin HEAT-like repeat 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001210   Gene: ENSVPAG00000001311   Transcript: ENSVPAT00000001311
Sequence length 1786
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1165:89953:189928:1 gene:ENSVPAG00000001311 transcript:ENSVPAT00000001311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQESQTKSMFVSRALEKILADKEVKRPQHSQLRRACQVALDEIKAEIEKQRLGAAAPPKA
NFIEADKYFLPFELACQSKSPRVVSTSLDCLQKLIAYGHITGNAPDSGAPGKRLIDRIVE
TICNCFQGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTILQTVRTCYNIYLASKNLINQT
TAKATLTQMLNVIFTRMENQVLQEARELEKPVQSKPQSPVIQAAAVSPKFNRLKQSQAQS
KPTTPEKTEVTNGEHATSASGKVSTENGDAPRERGPSLSGTEDGAQEVVKEILEDVVTSA
VKEAAQKHGLTEPERVLGELECQERAVPPAADENAQTNGIADDRQSLSSADNLESDAQGH
HVAARFSHILQKDAFLVFRSLCKLSMKPLGEGPPDPXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXPRNGVSSVPDVFELSLAIFLTPLSNFKMHLKMQIEVFFK
EIFLNILETSTSSFEHRWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSK
IAQGRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQTSLGQERPTDQ
EMGDGKGLDMARRSSVTSMESTVSSGTQTTVQDDPEQFEVIKQQKEMIEHGIELFNKKPK
RGIQYLQEQGMLGTSVEDIAQFLHQEERLDSTQVGDFLGESMKFNKEVMYAYVDQLDFCE
KEFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLAYSIIML
TTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYEEIEGKKIAMKETKEHTIAT
KSTKQSVASEKQRRLLYNLEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPMFKLVWT
PLLAAYSIGLQNCDDTEVASLCLEGIRCAIRIACIFGMQLERDAYVQALARFSLLTASSS
ITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKTRYLSGTGR
EREGSLKSHTLAGEEFMGLGLXXXXXXXXXXXXXXXXXXXXGETSSQSVVVAVDRIFTGS
TRLDGNAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTI
RDMVIRCIAQMVNSQAANIRSGWKNIFAVFHQAASDHDGNIVELAFQTTGHIVTTIFQHH
FPAAIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRFCGKYVSERPRVLQEYTSDDMNVA
PGDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKSYGHTFEKHWWQDLFRIVF
RIFDNMKLPEQQSEKSEWMTTTCNHALYAICDVFTQFYEALNEVLLSDVFAQLQWCVKQD
NEQLARSGTNCLENLVISNGEKFSPDVWDETCNCMLDIFKTTIPHVLLTWRPVGMEEDAA
EKHMDVDLDRQSLSSIDKNASERGQSQLSNPTDDSWKGRPYANQKLFASLLIKCVVQLEL
IQTIDNIVFYPATSKKEDAEHMAAAQQDTLDADIHIETXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXFKGKSKPNLLKQETSSLACCLRILFRMYVDENRRDSW
EEIQQRLLTVCSEALAYFITVNSESHREAWTSLLLLLLTKTLKINDEKFKAHASMYYPYL
CEIMQFDLIPELRAVLRKFFLRIGVVYKIWIPEEPSQVPGTLSPVW
Download sequence
Identical sequences ENSVPAP00000001210 ENSVPAP00000001210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]