SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002259 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002259
Domain Number 1 Region: 30-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000158
Family EGF-type module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002259   Gene: ENSVPAG00000002446   Transcript: ENSVPAT00000002445
Sequence length 134
Comment pep:novel genescaffold:vicPac1:GeneScaffold_909:103353:130453:-1 gene:ENSVPAG00000002446 transcript:ENSVPAT00000002445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFSSKPQALATPGKEERGKRKKKGKGLGKKRDPCLRKYKDYCIHGDCKYXXXXXXXXXXC
HPGYHGERCHGLSLPVKNRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDV
ENEEKVKLGMTASH
Download sequence
Identical sequences ENSVPAP00000002259 ENSVPAP00000002259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]