SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002829 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002829
Domain Number 1 Region: 443-663
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 7.98e-47
Family Hect, E3 ligase catalytic domain 0.0004
Further Details:      
 
Domain Number 2 Region: 61-166
Classification Level Classification E-value
Superfamily E set domains 0.00000000167
Family Filamin repeat (rod domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002829   Gene: ENSVPAG00000003059   Transcript: ENSVPAT00000003060
Sequence length 665
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1063:79955:91575:-1 gene:ENSVPAG00000003059 transcript:ENSVPAT00000003060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GITVSVVAFFFTIKFLFELAARVVSFLQNEDRERRGDRTIYDYVRGNYLDPRSCKVSWDW
KDPYEVGHSMAFRVHLFYKNGQPFPAHRPVGLRVHISHVELAVEIPVTQEVLQEPSSNVV
KVAFTVRRAGRYEISVKLGGLNVAYSPYYKIFQPGMVVPSKTKIVCHFSTLLLTCGQPHT
LQIVPRDEYDNPTNNSTSLRDEHNYSLSIHELGPQEDESTGVSFEKSVTSNRQTCQVFLR
LTLHSRGCFHACISYQNQPISNGEFDIIVLSENERNIVERNVSTSGVSIYFEAYLYNAAN
CTSTPWHLPPMHMSSAQRRPSTAVEEEEEDSPSECHTPEKVKKPKKVYCYVSPKQFSVKE
FYLKIIPWRLYTFRVCPGTKFSYLGPDPVHKLLTLVVDDGIQPPVELSCKERNILAATFI
RSLHKNIGGSETFQDKVNFFQRELRQVHMKRPHSKVTLKVSRHALLESSLKATRNFSISD
WSKNFEVVFQDEEALDWGGPRREWFELICKALFDTTNQLFTRFSDTNQALVHPNPNRPAH
LRLKMYEFAGRLVGKCLYESSLGGAYKQLVRARFTRSFLAQIIGLRMHYKYFETDDPEFY
KSKVCFILNNDMSEMELVFAEEKYNKSGQLDKVVELMTGGAQTPVTNANKIFYLNLLAQY
RLASQ
Download sequence
Identical sequences ENSVPAP00000002829 ENSVPAP00000002829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]