SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002865 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002865
Domain Number 1 Region: 172-478
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-94
Family Protein kinases, catalytic subunit 0.000000000106
Further Details:      
 
Domain Number 2 Region: 29-140
Classification Level Classification E-value
Superfamily PH domain-like 9.44e-22
Family Pleckstrin-homology domain (PH domain) 0.00000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002865   Gene: ENSVPAG00000003098   Transcript: ENSVPAT00000003098
Sequence length 506
Comment pep:novel genescaffold:vicPac1:GeneScaffold_3060:1624653:1826114:-1 gene:ENSVPAG00000003098 transcript:ENSVPAT00000003098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAAENPNPKAGITKYHFCKLGAQRGAIMSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTD
GSFIGYKEKPQDVDLPYPLNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVDTP
EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLK
LLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTGGILKNTRHPFLTSLKY
SFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLK
LENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLG
VVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGP
DDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYD
EDGMDCMDNERRPHFPQFSYSASGRE
Download sequence
Identical sequences ENSVPAP00000002865 ENSVPAP00000002865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]