SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002947 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002947
Domain Number 1 Region: 9-55
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000344
Family EGF-type module 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002947   Gene: ENSVPAG00000003188   Transcript: ENSVPAT00000003187
Sequence length 123
Comment pep:novel genescaffold:vicPac1:GeneScaffold_2672:753329:759835:-1 gene:ENSVPAG00000003188 transcript:ENSVPAT00000003187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTTQPKRRGHFSRCPRQYKHYCIKGRCRFVVAEQTPSCICEEGYAGARCERVDLFYLRGD
RGQILVICLIAVMVIFIILVVGVCTCCHPLRKHRKRRKKEEEMETLGKDTTPINEDIQET
SIA
Download sequence
Identical sequences ENSVPAP00000002947 ENSVPAP00000002947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]