SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003148 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003148
Domain Number 1 Region: 232-327
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000247
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 121-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000144
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003148   Gene: ENSVPAG00000003404   Transcript: ENSVPAT00000003404
Sequence length 613
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1375:119996:134929:-1 gene:ENSVPAG00000003404 transcript:ENSVPAT00000003404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGSATHPGAGGRRSKWDQPAPAPLLFLPPSAPGGEVAGSGGSPGGSTAAPSGALDAAA
AVAAKINAMLMAKGKLKPTQNATEKLQTPGKGLTSNKSKDDLVVAEVEINDVPLTCRNLL
TRGQTQDEISRLSGAAVSTRGRFMTTEEKAKVGPGDRPLYLHVQGQTRELVDRAVNRIKE
IITNGVVKAATGTSPTFNGATVTVYHQPAPIAQLSPAVSQKPPFQSGMHYVQDKLFVGLE
HAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISHP
KPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPGYTQPSAISSVPPQPPYPSNGYQ
SGYPVPPQQPVQPPYGVPSIVPPAVSLAPGVLPALPTGVPPVPTQYPITQVQPPASTGQS
PMSGPFIPAAPVKTALPAGPQPPPQPQPQPPLPSQPQAQKRRFTEELPDERESGLLGYQH
GPIHMTNLGTGFSSQNEIEGAGSKPASSSGKERERDRQLMPPPAFPVTGIKTESDERNGS
GTLTGSHDYPVKKMKTTEKGFGLVAYAADSSDEEEEHGGHKNASSFPQGWSLGYQYPSSQ
PRAKQQMPFWMAP
Download sequence
Identical sequences ENSVPAP00000003148 ENSVPAP00000003148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]