SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003907 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003907
Domain Number 1 Region: 704-801
Classification Level Classification E-value
Superfamily Sec7 domain 1.18e-39
Family Sec7 domain 0.000037
Further Details:      
 
Domain Number 2 Region: 404-587,1100-1488
Classification Level Classification E-value
Superfamily ARM repeat 1.66e-26
Family Diap1 N-terninal region-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003907   Gene: ENSVPAG00000004205   Transcript: ENSVPAT00000004205
Sequence length 1805
Comment pep:novel genescaffold:vicPac1:GeneScaffold_665:1751342:1834783:-1 gene:ENSVPAG00000004205 transcript:ENSVPAT00000004205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIKAETEKQSPPHGETKAGSSTLPPVKSKTNFIEADKYFLPFELACQSKCPRIVSTSLDC
LQKLIAYGHLTGNAPDSTTPGKKLIDRIIETICGCFQGPQTDEGVQLQIIKALLTAVTSQ
HIEIHEGTVLQAVRTCYNIYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQMEK
ERHRQHHHLLQSPVSHHEPESPQLRYLPPQTVDHISQEHEGDLDPHTNDVDKSLQDDTEP
ENGSDVSSAENEQTEADQATAAETLSKNDILYDGENHDCEEKPHDIVQSIVEEMVNIVVG
DMGERTTVNASADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQE
SGNSSGPSPGAKFSHILQKDAFLVFRSLCKLSMKPLSDGPPDPKSHELRSKILSLQLLLS
ILQNAGPIFRTNEMFINAIKQYLCVALSKNGVSSVPEVFELSLSIFLTLLSNFKTHLKMQ
IEVFFKEIFLYILETSTSSFDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERL
VNDLSKIAQGRGSQELGMSNVQELSLRKKGLECLVSILKCMVEWSKDQYVNPNSQTTLGQ
EKPPEQETSEIKHPETINRYGSLNSLESTSSSGIGSYSTQMSGTDNPEQFEVLKQQKEII
EQGIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQVGEFLGDNDKFNKEV
MYAYVDQHDFSGKDFVSALRMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASAD
TAYVLAYSIIMLTTDLHSPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXVASEKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHL
EHVRPMFKLAWTPFLAAFSVGLQDCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQA
LARFTLLTVSSGITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQSVV
VAVDRIFTGSTRLDGNAIVDFVRWLCAVSMDELLSTTHPRMFSLQKIVEISYYNMGRIRL
QWSRIWEVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEH
IMKRNRSPTIRDMVVRCIAQMVNSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQTTG
HIVTLVFEKHFPATIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRHCAKYVSDRPQAFK
EYTSDDMNVAPEDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKTYGHTYEKH
WWQDLFRIVFRIFDNMKLPEQQTEKAEWMTTTCNHTLYAIYDVFTQYLEVLSDVLLDDIF
SQLYWCVQQDNEQLARSGTNCLENVVILNGEKFTLEIWDKTCNCTLDIFKTTIPHAXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSEALSYFLTLTSESHREAWTNLLLL
FLTKVLKISDNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPEPE
GINKQ
Download sequence
Identical sequences ENSVPAP00000003907 ENSVPAP00000003907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]