SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004055 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004055
Domain Number 1 Region: 892-1014
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.44e-57
Family Thrombospondin C-terminal domain 0.000000392
Further Details:      
 
Domain Number 2 Region: 769-890
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.32e-37
Family TSP type-3 repeat 0.000000134
Further Details:      
 
Domain Number 3 Region: 3-147
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.33e-24
Family Laminin G-like module 0.000000191
Further Details:      
 
Domain Number 4 Region: 373-422
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.66e-16
Family TSP-1 type 1 repeat 0.0000342
Further Details:      
 
Domain Number 5 Region: 429-479
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 6.02e-16
Family TSP-1 type 1 repeat 0.0000341
Further Details:      
 
Domain Number 6 Region: 701-771
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000654
Family TSP type-3 repeat 0.00022
Further Details:      
 
Domain Number 7 Region: 628-712
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000353
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 8 Region: 317-366
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000353
Family TSP-1 type 1 repeat 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004055   Gene: ENSVPAG00000004363   Transcript: ENSVPAT00000004364
Sequence length 1014
Comment pep:novel genescaffold:vicPac1:GeneScaffold_2913:536308:550613:1 gene:ENSVPAG00000004363 transcript:ENSVPAT00000004364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDALIPPVPDNKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLAVERKDHSGQVFSVVSN
GKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVP
IQSIFTRDLASIARLRIAKGGVNDNFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSVTICKKVSCPIMPCSNAT
VPDGECCPRCWPSDSADDGWSPWSEWTSCSATCGNGIQQRGRSCDSLNNRCEGSSVQTRT
CHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETK
ACQKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPHFGGKDCVSDVTENQICK
QDCPIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCKPRNPCTDGTHDCNKNAKC
NYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPNLPN
SGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNP
DQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEHNPD
QLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGI
PDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENVDISETDFRRFQMI
PLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYA
GFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLR
Download sequence
Identical sequences ENSVPAP00000004055 ENSVPAP00000004055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]