SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004542 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSVPAP00000004542
Domain Number - Region: 488-505,609-712
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000173
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004542   Gene: ENSVPAG00000004903   Transcript: ENSVPAT00000004904
Sequence length 1081
Comment pep:novel genescaffold:vicPac1:GeneScaffold_2034:1146:396751:-1 gene:ENSVPAG00000004903 transcript:ENSVPAT00000004904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIAGLCALLPCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISGNTEDIPLVRWRQQWLENGTLLF
HIHHQDGAPSLPGQDPTEEPQHESAEEELRILHISVMXXXXXXXXXXXXXXXXLYTRRRW
CKRRRVPQKSASAEAANEIHYIPSVLIGGHGRESLRNARVQGHNSSGTLSIRETPILDGY
EYDITDLRHHLQRECMNGGEDFASQVTRTLDSLQGCNEKAGMDLTPGSDNAKLSLMNKYK
DNIIATSPVDANHQQASLLSHTSSSQRKRINSKARAGSAFLNPEGDSSTEAENDPQLTFY
TDPSRSRRRSRVGSPRSPVNKTTLTLISITSCVIGLVCSSHVSCPLVVKITLHVPEHLIA
DGSRFILLEGSQLDASDWLNPAQVVLFSQQNSSGPWAMDLCARRLLDPCEHQCDPETGRR
ERRAAGECLCYEGYMKDPVHKHLCIRNEWGTNQGPWPYTIFQRGFDLVLGEQPSDKIFRF
TYTLGEGMWLPLSKSFVIPPAELAINPSAKCKTDMTVMEDAVEVREELMTSSSFDSLEGL
LDSFGPVRDCSKDNGGCSKNFRCISDRKLDSTGCVCPSGLSPMKDSSGCYDRHIGVDCSD
GFNGGCEQLCLQQMAPFPDDPPMYNILMFCGCIEDYKLGVDGRSCQLITETCPEGSDCGE
SRELPMNQTLFGEMFFGYNNHSKEVAAGQVLKGTFRQNNFARGLDQQLPDGLVVATVPLE
NQCLEEISEPTPDPDFLTGMVNFSEVSGYPVLQHWKVRSVMYHIKLSQVAVSQALSNALH
SLDGATSRGDFVALLDQFGNHYIQEAVYGFEESCSIWYPNKQVQRRLWLEYEDISKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXLLLEATMSSLWCSGTGDVIEDWCRCDSTAFGADG
LPTCAPLPQPVLRLSTVHEPSSTLVVLEWEHSEPPIGVQIVDYLIRQEKVTDRMDHSKVE
T
Download sequence
Identical sequences ENSVPAP00000004542 ENSVPAP00000004542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]