SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004543 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004543
Domain Number 1 Region: 564-674
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-37
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 2 Region: 725-831
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.3e-36
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 3 Region: 415-517
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-36
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 4 Region: 299-408
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-35
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 5 Region: 855-948
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-28
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 6 Region: 101-253
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.31e-28
Family Astacin 0.00083
Further Details:      
 
Domain Number 7 Region: 675-717
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000023
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 519-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000729
Family EGF-type module 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004543   Gene: ENSVPAG00000004905   Transcript: ENSVPAT00000004905
Sequence length 959
Comment pep:novel genescaffold:vicPac1:GeneScaffold_2979:216192:359059:-1 gene:ENSVPAG00000004905 transcript:ENSVPAT00000004905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCKAAVFWGDIALDEEDLKLFQIDKAHDWVKQSVEETGHSTGGLGEQPSESWPNTTATNT
SHKEAREDGKENAVLPQSPGTLRAGAENFSPRVRRATTSRTERIWPGGVIPYVIGGNFTX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCCSYVGRRGGGPQAISIGKNC
DKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPQEYNFLKEAGEVSSLGETYDFD
SIMHYARNTFSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGETLQ
DTTGNFSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYW
RKAPLLGRFCGDKVPEALISTDSRLWVEFRSSSNILGKGFFAVYEATCGGDVNKDAGQIQ
SPNYPDDYRPSKECVWRITVSEGFHVGLTFQAFEIERHDSCAYDYLEIRDGPTEESALIG
HFCGYEKPEDVKSSSNRMWMKFVSDASINKAGFAANFFKEVDECSWPDHGGCEQRCVNTL
GSYKCVCDPGYELAADKKACEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQY
RISLQFEVFELEGNDVCKYDFVEVRSGLPPDARLHGKFCGSETPEVITSQSSNMRVEFKS
DSTVSKRGFRAHFFSDKDECAQDNGGCQHECVNTFGSYLCRCRNGYRLHDNGLDCKEAGC
AHKISSAEGTLVSPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLEL
YDGPDSLAPVLGRFCGSKKPDPVVASGSSLFLRFYSDASVQRRGFQAVHSTECGGRLKAE
VQTKELYSHAQFGDNNYPSQARCDWVIVAEDGYGVELIFRTFEVEEEADCGYDYMEAFDG
YDSTAPRLGRFCGSGPLEEIYSAGDSLMIRFHTDDTINKKGFHARYTSTKFQDALHMKK
Download sequence
Identical sequences ENSVPAP00000004543 ENSVPAP00000004543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]