SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005455 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005455
Domain Number 1 Region: 795-903
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-22
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 2 Region: 224-263,308-384
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 3 Region: 4-82
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000115
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 4 Region: 132-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000681
Family EGF-type module 0.019
Further Details:      
 
Domain Number 5 Region: 172-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005455   Gene: ENSVPAG00000005873   Transcript: ENSVPAT00000005873
Sequence length 980
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1882:144759:181714:1 gene:ENSVPAG00000005873 transcript:ENSVPAT00000005873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDECVEGTDNCHIDAICQNTPRSYKCICKSGYTGDGKHCKDVDECEREDNAGCVHDCVNI
PGNYRCTCYDGFHLAHDGHNCLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXGMNCMNKNHGCAHICRETPKGGIACECRPGFELTKNQRDCKLTCNYGNGGCQ
HTCDDTEQGPRCGCHVKFVLHTDGKTCIXXXXXXXXXXXXXXXXXTCAVNNGGCDSKCHD
AATGVHCSCPVGFMLQPDRKTCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXIDECSFDRTCDHICVNTPGSFQCLCHHGYLLYGVTHCGDVDECSINRGGCRFGCI
NTPGSYQCTCPASQGRLHWNGKDCTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXQCSPGHYYNTSIHRCIRCAMGSYQPDFRQNFCTRCPGNTSTDFDGS
TSVAQCKNRQCGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKRKILIVVPEIFLPS
EDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQIPY
VTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAHPQNYFKYTEKHKEML
PKSFIKLLRSKVSSFLRPYK
Download sequence
Identical sequences ENSVPAP00000005455 ENSVPAP00000005455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]