SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000005507 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000005507
Domain Number 1 Region: 298-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000152
Family Laminin-type module 0.071
Further Details:      
 
Domain Number 2 Region: 21-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000624
Family EGF-type module 0.034
Further Details:      
 
Domain Number 3 Region: 258-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000825
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000005507
Domain Number - Region: 124-173
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0176
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number - Region: 4-23
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0776
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000005507   Gene: ENSVPAG00000005932   Transcript: ENSVPAT00000005933
Sequence length 347
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1044:140530:181651:-1 gene:ENSVPAG00000005932 transcript:ENSVPAT00000005933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRENWFCECPRLYSGKLCQFATCENNPCGNGATCVPKSGTDIICLCPYGRSGLLCTEXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL
SGEDFLAVLRGGSVVYSYNLGSGTASISSDPLDLSRGVHTVHLGRSFRTGWLKXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCIFTLQVRTKKKGHFRSL
GSPEGHPSAGRSVGQCDASPCSLMQCGNGGTCVESGATVYCNCPSGWKGALCTETISTCD
PEHDPPHHCSQGATCVPLPRGYTCYCPLGTTGVYCEQGEAEPRLMPS
Download sequence
Identical sequences ENSVPAP00000005507 ENSVPAP00000005507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]