SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006739 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006739
Domain Number 1 Region: 179-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000278
Family EGF-type module 0.017
Further Details:      
 
Domain Number 2 Region: 124-271
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000769
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006739   Gene: ENSVPAG00000007250   Transcript: ENSVPAT00000007247
Sequence length 522
Comment pep:novel genescaffold:vicPac1:GeneScaffold_773:440704:499820:1 gene:ENSVPAG00000007250 transcript:ENSVPAT00000007247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQFLLLTCFFITITPASPMXXXXXXAYISLNEPWRNTDHEFDESQGSPLCDNNVDGEWY
RFTGMAGDAMPTFCIPENHCGTHAPVWLNGSHPLEGDGIVQRQACASFSGNCCLWNTTVE
VKACPGGYYVYRLTKPSVCFHVYCGHFYDICDEDCHGSCLDTSECTCSPGTVLGPDRQTC
FDENECEQNNGGCSEICVNLKNSYRCECGVGRVLRSDGKTCEDIEGCHNNNGGCSHSCLM
SETGYQCECPRGLVLSEDNHTCQVPVMCKSNTIEVSIPRDLVGGLELFLTNTSCRGVSNG
THVNILFSLKTCGTVVDVVNDKIVASNLVTGLPKPTPGSSGDIIIRTSKLLIPVTCEFPR
LYTISEGYVPNLRNTPLEIMSRNHGIFPFTLEIFKDNEFEEPYREALPTLKLRDSLYFGI
EPLVHVNGLESLVESCFATPTSKIDEILKYYLIRDGCVSDDSVKQYEVFLHCRVLVCGML
DERSRCAQGCHRRVRREAVGYDAAGLQSQTLTGGPISIDWED
Download sequence
Identical sequences ENSVPAP00000006739 ENSVPAP00000006739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]