SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006979 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006979
Domain Number 1 Region: 2273-2345
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.62e-19
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 2 Region: 909-978
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.1e-19
Family TB module/8-cys domain 0.00062
Further Details:      
 
Domain Number 3 Region: 1624-1695
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.23e-18
Family TB module/8-cys domain 0.00043
Further Details:      
 
Domain Number 4 Region: 1988-2059
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.31e-18
Family TB module/8-cys domain 0.0000985
Further Details:      
 
Domain Number 5 Region: 2066-2200
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.71e-18
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 671-813
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 2388-2515
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.33e-16
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 8 Region: 124-209
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.27e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 9 Region: 804-888
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.76e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 10 Region: 609-681
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000235
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 11 Region: 2159-2275
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000008
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 12 Region: 1031-1157
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000863
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 13 Region: 1344-1466
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000706
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 14 Region: 1543-1598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000123
Family EGF-type module 0.00064
Further Details:      
 
Domain Number 15 Region: 2512-2628
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 16 Region: 488-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000103
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 17 Region: 530-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000061
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 18 Region: 1949-2002
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000113
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 19 Region: 165-275
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 20 Region: 408-501
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000033
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 21 Region: 1685-1786
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000957
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 22 Region: 2343-2386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000113
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 23 Region: 1309-1348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000225
Family EGF-type module 0.038
Further Details:      
 
Domain Number 24 Region: 571-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000173
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 25 Region: 1785-1837
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000036
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 26 Region: 1915-1962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000959
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 27 Region: 1828-1864
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000666
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 28 Region: 1150-1185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000925
Family EGF-type module 0.028
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000006979
Domain Number - Region: 95-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00239
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 2720-2766
Classification Level Classification E-value
Superfamily Cadherin-like 0.00722
Family Cadherin 0.016
Further Details:      
 
Domain Number - Region: 61-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0681
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006979   Gene: ENSVPAG00000007497   Transcript: ENSVPAT00000007501
Sequence length 2805
Comment pep:novel genescaffold:vicPac1:GeneScaffold_3525:632040:857590:-1 gene:ENSVPAG00000007497 transcript:ENSVPAT00000007501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSSGQISPTCGSKS
IQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVCENGCQNGGRCIGPNRCACVYGFTGP
QCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRAWGHPCEMCPAQPQPCRRGF
IPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECKCPAGHKQSETTQKCEDIDECSII
PGICETGECSNTVGSYFCVCPRGYVTSTDGSRCIXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXEYRRLCMDGLPIGGIPGSAGSRPGGTGGNGFAPS
GNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQTIDICKHHANLC
LNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNPCTNGDCVNTPGSYYCKCHAGFQ
RTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTTN
MCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDECQTPGICMNGHCINNEGSFRCDCP
PGLAVGVDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPCP
AKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDASG
RNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEDINECESNPCVNGA
CRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWLNIQDNRCEVNINGATLKSECCATLG
AAWGSPCERCELDTACPRGFARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEG
LTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKAGT
KEYETLCPRGPGFANRGDVLTGRPFYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXIDECRISPDLCGSGVCVNTPGSFECECFEGYESGFMMMKNCMDIDECERN
PLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQC
SCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVDECEIGANNCDMHASCLIVPGSFNCSKGWVEXXXXXXXLDECSNGTHQCSIN
AQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTP
ASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINC
VNGLCVNTPGRYECNCPPDFQLNPTGVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXTCPPVSITEYYTLGPGGEGFRPNPITIILEDIDECQELPGLCQGGN
CINTFGSFQCECPQGYYLSEETRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQ
VNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTA
DFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLL
LVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLAPSGACVDRNECLEIPNVCSH
GLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFEL
THNNDCLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNECVALPG
SCSPGTCQNLEGSFRCICPPGYEVKSENCIDINECDEDPNICLFGSCTNTPGGFQCICPP
GFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPK
DDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLD
YTGVRCVDTDECSIGNPCGNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCA
FRCMNTFGSYECTCPTGYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPP
GMTRRPDGEGCVDENECRTKPGICENGRCINTIGSYRCECNEGFQSSSSGTECLDNRQGL
CFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTT
DGRDIDECKVMPNLCTNGQCINTMGSFRCFCKVGYTTDISGTSCVDLDCSQSPKPCNFIC
KNTEGSYQCSCPRGYVLQEDGKTCRDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHH
TACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQH
GCQNILGGYRCGCPQGYIQHYQWNQCVDENECSNPNACGSASCYNTLGSYKCACPSGFSF
DQFSSACHDVNECSSSKNPCNYGCSNTEGGYLCGCPPGYYRVGQGHCVSGMGFNKGQYLS
LDAEVDEENALSPETCYECKINGYKKDSRQKRSIHEPKPTEVEQISLESVDMDSPMKMKF
NLSGLGSKEHILELMPAIEPLNNHIRYVISQGNEDGIFRIHQRNGLSYLHTAKRKLVPGT
YTLEITSIPLYKKKELKKLEDSNEDDYLLGELGEALRMRLQIQLY
Download sequence
Identical sequences ENSVPAP00000006979 ENSVPAP00000006979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]