SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007123 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007123
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily DEATH domain 1.62e-23
Family Caspase recruitment domain, CARD 0.0000109
Further Details:      
 
Domain Number 2 Region: 109-193
Classification Level Classification E-value
Superfamily DEATH domain 6.12e-20
Family DEATH domain, DD 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007123   Gene: ENSVPAG00000007660   Transcript: ENSVPAT00000007659
Sequence length 199
Comment pep:novel genescaffold:vicPac1:GeneScaffold_3409:158141:379369:1 gene:ENSVPAG00000007660 transcript:ENSVPAT00000007659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGVLTENHVQEIKAQATGLRKTMLLLDI
LPSRGPKAFDAFLDSLQEFPWVREKLEKAREETIVELPADDWMTGIPPHILNSSPSDRQI
NQLAQRLGPEWEPVVLSLGLSQTDIYRCKANHPHNVQSQMVEAFVRWRQRYGKQATFQSL
HRGLQAMEVDPSVFQHMLE
Download sequence
Identical sequences ENSVPAP00000007123 XP_006197965.1.17985 ENSVPAP00000007123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]