SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007882 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007882
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 9.15e-25
Family Rap30/74 interaction domains 0.00000263
Further Details:      
 
Domain Number 2 Region: 166-233
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.85e-23
Family DNA-binding domain from rap30 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007882   Gene: ENSVPAG00000008468   Transcript: ENSVPAT00000008468
Sequence length 240
Comment pep:novel genescaffold:vicPac1:GeneScaffold_3275:55459:191263:1 gene:ENSVPAG00000008468 transcript:ENSVPAT00000008468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERGELDLTGAKQNTGVWLVKPYLSQQWAKAPGXXXXXXXXXXVSFTLNEDLANIHDIG
GKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMRLKR
LQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFS
AFEKHQYYNLKDLVDITKQPVLYLKEILREIGIQNVKGIHKNTWELKPEYRHYQGEEKSD
Download sequence
Identical sequences ENSVPAP00000007882 ENSVPAP00000007882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]