SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007983 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007983
Domain Number 1 Region: 2-172
Classification Level Classification E-value
Superfamily E set domains 1.26e-74
Family Arrestin/Vps26-like 0.000000337
Further Details:      
 
Domain Number 2 Region: 174-253
Classification Level Classification E-value
Superfamily E set domains 6.09e-22
Family Arrestin/Vps26-like 0.00037
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000007983
Domain Number - Region: 303-377
Classification Level Classification E-value
Superfamily E set domains 0.00308
Family Arrestin/Vps26-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007983   Gene: ENSVPAG00000008577   Transcript: ENSVPAT00000008577
Sequence length 389
Comment pep:novel genescaffold:vicPac1:GeneScaffold_377:76522:88865:1 gene:ENSVPAG00000008577 transcript:ENSVPAT00000008577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSKVFKKTCSNGKLSIYLGKRDFVDHVDMVEPIDGVVLVDPDYLKGRKMFVMLTCAFRYG
HDDLDVIGLTFRKDLYVQVQQVVPAEPSSPQGPLTVLQERLLHKLGENAYPFTLQMVVNL
PCSVALQPGPDDTGKSCGVDFEVKSFCAENLEEKVSKRDSVRLVIRKIQFAPLEPGPGPW
AQTVRRFLLSAQPLQLQAWMDREVHYHGKPIAVNVSINNSTNKVIKKIKISVDQTTDVVL
YSLDKYTKTVIQEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XLRPGVDKELLGILVSYKVRVNLMVSCGGILGDLTAXXXXXXXXXXXXXXXXXXASASSE
DIVIEEFARQEPGSEENQEALAAEGDEGS
Download sequence
Identical sequences ENSVPAP00000007983 ENSVPAP00000007983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]