SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008042 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008042
Domain Number 1 Region: 393-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.18e-36
Family Protein kinases, catalytic subunit 0.0000031
Further Details:      
 
Domain Number 2 Region: 118-246
Classification Level Classification E-value
Superfamily SH2 domain 1.85e-33
Family SH2 domain 0.0000292
Further Details:      
 
Domain Number 3 Region: 70-142
Classification Level Classification E-value
Superfamily SH3-domain 2.08e-17
Family SH3-domain 0.00032
Further Details:      
 
Domain Number 4 Region: 252-319
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000039
Family Protein kinases, catalytic subunit 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008042   Gene: ENSVPAG00000008636   Transcript: ENSVPAT00000008636
Sequence length 527
Comment pep:novel genescaffold:vicPac1:GeneScaffold_2358:989999:1054448:-1 gene:ENSVPAG00000008636 transcript:ENSVPAT00000008636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILSTYNTIQSIFCCCCCCSVQKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSN
SGRVQPSKRKPLPPLPPSEVAEERIQVKALYDYLPREPYDLALKRAEEYLILEKYNPHWW
KARDRLGNEGLIPSNYVTENKPTNLEIYEWYHKNITRNQAERLLRQESKEGAFIVRDSRH
LGSYTISVFIKARRSMEATIKHYQIKRNDSEQWYVAERHLFQSVPELVWYHQHNAAGLMS
RLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFVKEIGSGQFGVVHLGKWRAHVQVAIKA
INEGSMSEEDFIEEAKVMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAARNCLVSSTSIVKISDFGMTRYVLDDEY
ISSSGAKFPIKWSPPEVFHFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
KGFRLYRPHLAPMSLYEVMYSCWHEKPAGRPTFAELLRALTEIAETW
Download sequence
Identical sequences ENSVPAP00000008042 ENSVPAP00000008042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]