SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008143 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008143
Domain Number 1 Region: 41-514
Classification Level Classification E-value
Superfamily Sema domain 1.96e-154
Family Sema domain 0.0000000000000858
Further Details:      
 
Domain Number 2 Region: 1092-1354
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-79
Family Protein kinases, catalytic subunit 0.000000000154
Further Details:      
 
Domain Number 3 Region: 653-727
Classification Level Classification E-value
Superfamily E set domains 5.6e-16
Family E-set domains of sugar-utilizing enzymes 0.035
Further Details:      
 
Domain Number 4 Region: 559-655
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000205
Family Other IPT/TIG domains 0.095
Further Details:      
 
Domain Number 5 Region: 516-562
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000366
Family Plexin repeat 0.0000846
Further Details:      
 
Domain Number 6 Region: 739-837
Classification Level Classification E-value
Superfamily E set domains 0.0000229
Family Other IPT/TIG domains 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008143   Gene: ENSVPAG00000008745   Transcript: ENSVPAT00000008748
Sequence length 1401
Comment pep:novel genescaffold:vicPac1:GeneScaffold_719:375538:463465:1 gene:ENSVPAG00000008745 transcript:ENSVPAT00000008748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSPAVLAPGILVLLFTLVQKSNGECKEALVKSRMNVNMQYQLPNFTAETPIQNVVLHKH
HIYLGAVNYIYVLNDKDLEKVAEYKTGPVLEHPHCFPCEDCSHKANLSDGVWKNNINMAL
LVDTYYDDQLISCGSVHRGTCQRHVLPPHTADIQSEVYCMYSPQTDEEPGQCPDCVVSAL
GTKLLSEKDRFINFFVGNTINSSYLPDHSLHSISVRRLKETQDGFKFLTDQSYIDVLPEF
QDTYPIKYVHAFESNHFIYFLTVQRETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECILT
EKRRRRSTKEEVFNILQAAYVSKPGSQLAKQIGANLNDDILYGVFAQSKPDSAEPMNRSA
VCAFPVKYVNEFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEVRNDEYRTEFT
TALQRVDLFTGQFNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGLSTPHVNFLL
DSHPVSPEAIVEHPLNQNGYTLVVTGKKITKIPLNGLGCEHFQSCSQCLSAPSFVQCGWC
HDKCVQLEECSGGIWTQEICLPTIYKVLPTSAPLEGGTTLTICGWDFGFRRNNKSDLKKT
KVFLGNESCTLTLSESTTNTLKCTVGPAMNEHFNVSIIISNNRGTAQYSTFSYVDPIITS
ISPSYGPKTGGTLLTLTGKHLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQTTPTEFP
VKLKIDLANREINSFSYREDPVVYEIHPTKSFISTKEPLNIAIFSFIFASGGSTITGVGK
YLNSVSVLRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPVKTKAFFMLDG
IHSKHDLIYVHNPVFKPFEKPVMISIGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIH
SHSEAVLCTVPNDLLKLNSELNIEWKQAVSSTVLGKVIVQPDQNFTGLIVGVVLISIILL
SLGLFLWLKKRKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATF
PEDQFPNTTQNGSCRQVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQ
HVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDDKKIHCAVKSLNRITDIGEVSQFLTE
GIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQ
VAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDVYDKEYYSVHNKTGAKLPV
KWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEY
CPDPLYEVMLKCWHPKAELRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPS
LLSPQEHVNGEGDTSGPFETS
Download sequence
Identical sequences ENSVPAP00000008143 ENSVPAP00000008143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]