SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008304 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008304
Domain Number 1 Region: 2317-2384,2496-2572,2670-2695,2729-2751
Classification Level Classification E-value
Superfamily Sialidases 0.000000000726
Family Sialidases (neuraminidases) 0.047
Further Details:      
 
Domain Number 2 Region: 544-597,741-816,897-925
Classification Level Classification E-value
Superfamily Sialidases 0.000000569
Family Sialidases (neuraminidases) 0.034
Further Details:      
 
Domain Number 3 Region: 1636-1661,1688-1753,1833-1941,1984-2045,2201-2232
Classification Level Classification E-value
Superfamily Sialidases 0.0000139
Family Sialidases (neuraminidases) 0.02
Further Details:      
 
Domain Number 4 Region: 2546-2600,2725-2750,2904-2978,3301-3318
Classification Level Classification E-value
Superfamily Sialidases 0.0000491
Family Sialidases (neuraminidases) 0.021
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000008304
Domain Number - Region: 1365-1397,1723-1741,2077-2117
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00152
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 2439-2464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00195
Family Integrin beta EGF-like domains 0.016
Further Details:      
 
Domain Number - Region: 1481-1522,1639-1691
Classification Level Classification E-value
Superfamily Sialidases 0.00271
Family Sialidases (neuraminidases) 0.045
Further Details:      
 
Domain Number - Region: 635-660
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0106
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 1108-1178,1268-1329
Classification Level Classification E-value
Superfamily Sialidases 0.0123
Family Sialidases (neuraminidases) 0.039
Further Details:      
 
Domain Number - Region: 2815-2839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0558
Family EGF-type module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008304   Gene: ENSVPAG00000008925   Transcript: ENSVPAT00000008926
Sequence length 3401
Comment pep:novel genescaffold:vicPac1:GeneScaffold_2280:458195:957540:-1 gene:ENSVPAG00000008925 transcript:ENSVPAT00000008926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HHGELEGDGEQGEVLISLHIAGHPTLVSGQESHVTISTSTFFDGLLVTGLYTSTSVQASQ
SIGGSSAFGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATAT
HRGQIIFKDALAQQLCEQGAPTEATVHPHLAELHSDSIILRDDFDSYHQQELNPNIWVEC
NNCETGEQCGAIMHGNAVTFCEPYGPRELITTALNTTTASVLQFSIGSGSCRFSYSDPCI
IVSYAKNNTADWIQLEKIRAPSNVSTIIHILYLPEAAKAENVQFQWKQENLREGDVYEAC
WALDNILVINSAHRQVVLEDSLDPVDTGNWLFFPGATVKHSCQSDGNSIYFHGNEGSEFN
FATTRDVDLSTEDIQEQWSEEFESQPTGWDILGAVIGTECGTIESGLSMVFLKDGERKIC
TPYMDTTGYGNLRFYFVMGGMCDPGDSHENDIILYAKTEGRKEHVALDTLSYSSYKVPSL
VSVVINPDLQTPATKFCLRQKNHQGHNRNVWAVDFFHVLPVLPSTMSHMIQFSINLGCGT
HQPGNSVSLEFSTNHGRSWSLLHTECLPEICAGPHLPHSTIYSSENYSGWNRITIPLPNA
ALTRDTRIRWRQAGPILGNMWAIDNVYIGPSCLKFCSGRGQCTRHGCKCDPGLSGPACEM
ASQTFPMFISESFGSSRLSSYHNFYSIRGEEVSVSCGVLASGKALVFNKDGRRQLITSFL
DSSQSRFLQFTLRLGSKSVLSTCRAPDQPGEGVLLHYSYDNGITWKLLEHYSYLNYHEPR
IISVELPDDARQFGIQFRWWQPYHSSQGEDVWAIDEIIMTSVLFNSISLDFTNLVEVTQS
LGFYLGNVQPYCGHDWTLCFTGDSKLASMRYVETQSMWEFSYMIQFSLVMGCGQKYTPHM
DNQVKLEYSTNHGLTWHLVQEECLPSMPSCQEFTAASIYHASEFTQWRRVIVLLPQKTXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCDQGYQGTDCRPEAA
LPSTIMSDFESPNSWESDWQEVIGGEIVKPEEGCGVISSGSSLYFSKAGKRQLVSWDLDT
SWVDFVQFYIQIGGESAACNKPDSREEGVLLQYSNNGGIQWHLLAEMYFSDFSRPRFVYL
ELPAAAKTPCTRFRWWQPVFSGEDYDQWAVDDIIILSEKQKQIIPVVNPTLPQNFYEKPA
FDYPMNQMSVWLMLANEGMVKNETFCSATPSAMVFGKSDGDRFAVTRDLTLKPGYVLQFH
LNIGCANQFSSAAPVLLQYSHDAGMSWFLVKEGCYPASVGKGCEGNSRELSEPTMYHTGD
FEEWTRITIVIPRSLASSKTRFRWIQESSSQKNVPPFGLDGVYISEPCPSYCSGHGDCVS
GVCFCDLGYTAAQGTCVSIVPNPSEMFDRFEGKLSPLWYKITGGQVGTGCGILNDGKSLY
FSGSGKREARTVPLDTRNIRLVQFYIQIGSKTSGITCIKPRARNEGLVVQYSNDNGILWH
LLRELDFMSFLEPQIISIDLPREAKTPATAFRWWQPQHGKHSAQWALDDVLIGVNDSSQT
GFQDKFDGSLDLQANWYRIQGGQVDIDCLSMDTALIFTENIGKPRYAETWDFHVSASTFL
QFEMSMGCSKPFSASHGVQLQYSLNNGRDWHLVTEECVPPTIGCLHYTESSIYTSERFQN
WKRITVYLPFSTISPRTRFRWIQANYTVGADSWAIDNVVLASGCPWMCSGRGVCDAGRCV
CDRGFGGTYCVPFLPLPSILKDDFNGNLHPDLWPEVYGAERGNLNGETIKSGTSLIFKGX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXTPERSHSILLQFSINGGITWHLMDEFYFPQTT
NILFINVPLPYTAQTNATRFRLWQPYNNGKKEEIWIVDDFIIDGNNLNNPVMLLDTFDFG
PREDNWFFYPGGNIGLYCPYSSKGAPEEDSAMVFVSNEVGEHSITTRDLNVNENTIIQFE
INVGCSTDSSSADPVRLEFSRDFGATWHLLLPLCYHSSSHVSSLCSTEHHPSSTYYAGTT
QGWRREVVHFGKLHLCGSVRFRWYQGFYPAGSQPVTWAVDNVYIGPQCEEMCNGHGSCIN
GTKCICDPGYSGPTCKISTKNPDFLKDDFEGQLESDRFLLMSGGKPSRKCGILSSGNNLF
FNEDGLRMLMTRDLDLSHARFVQFMRLGCGKGVPDPRSQPVLLQYSLNGGLSWSLLQEFL
FSNSSNVGRYIALEIPLKARSASARLRWWQPSENGHFYSPWVIDQILIGGNIYGNTVLED
DFTTLDSRKWMLHPGGTKMPMCGSTGDALVFIEKASTRYVVTTDIAVNEDSFLQIDFAAS
CSVTDSCYAIELEYSIDLGLSWHPLVRDCLPTNVECSRYHLQRVLVSDTFNKWTRITLPL
PPYTRSQATRFRWHQPAPFDKQQTWAIDNVHIGDGCVDMCSGHGRCIQGDCVCDEQWGGL
YCDEPETSLPTQLKDNFNRAPSNQNWLTVNGGKLSTVCGAVASGMALHFSGGCSRLLVTV
DLNLTNAEFIQFYFMYGCLITPNNRNQGVLLEYSVNGGITWNLLMEIFYDQYSKPGFVNI
LLPPDAKEMATRFRWWQPRHDGLDQNDWAIDNVLISGSADQRTVMLDTFSSAPVPPHERS
PADAGPVGRIAFDMFMEDKTAVNEHWLFHDDCTVERFCDSPDGVMICGSHDGREVYAVTH
DLTPTEGWIMQFKISVGCKVSEKVAQNQIHVQYSTDFGVSWNYLVPQCLPADPXXXXXXX
XXXXXXXXXXXXXXXXXXXXSLVGNSVRFRFYQKHSDMQWAIDNFYLGPECLDNCRGHGD
CLKEQCICDPGYSGPNCYLTHTLKTFLKERFDSEEIKPDLWMSLEGGSTCTECGILAEDT
ALYFGGSTVRQAITQDLDLRGAKFLQYWGRIGSENNMTSCHRPICRKEGVLLDYSTDGGI
TWILIHEMDYQKYISVRHDYILLPEDALSNTTRLRWWQPFVICNGLVVSGGAXXXXXXXX
XXXXXXGTSHEENWSFYPNAVRTAGFCGNPSFHLYWPNKKKDKTHNALSSRELIIQPGYM
MQFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXATQFRWIQKGEEAEKQSWAIDHVYIGEACPKLCSGHG
YCTTGAVCICDESFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIMFVLQIGSASQTDSCNSDLSGPHAVDKAV
LLQYSVNNGITWHVIAQHQPKDFTQAQRVSYNVPLXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXSSTRKQNYMMNFSRQHGLRHFYNRRRRSLRRYP
Download sequence
Identical sequences ENSVPAP00000008304 ENSVPAP00000008304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]