SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000008321 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000008321
Domain Number 1 Region: 24-85
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.27e-26
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-26
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 245-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 357-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.54e-19
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000008321   Gene: ENSVPAG00000008945   Transcript: ENSVPAT00000008945
Sequence length 414
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1743:78581:104104:-1 gene:ENSVPAG00000008945 transcript:ENSVPAT00000008945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASALYCGALPFSVRGAQRRTNIKAMAQGSVMFSDVSIDFSQEEWECLNDDQRDLYRDVML
ENYSNLVSMGHCISKPDVISFLEQGKEPWLVDREPTRYQWPVLESRCETKKLFLKKEIYE
IESAQWEIMERLTRHDLQCSSFRGDWECNGQFERQPGSQEGHFSQLIFTHEGMPTFSQHP
SLTLQQIINNKEKYCATKEYRKNFRHDSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXHTGEKPYECKECGKAFSSGSNFTRHQRIHTGEKPYECKECGKAFSSGSNFTQHQRI
HTGEKPYECKECGNAFSQSSQLIKHQRIHTGEKPYECKECEKAFRSGSDLTRHQRIHTGE
KPYECKICGKAYSQSSQLISHHRIHAGEKPYEYRECGKTFNYDSQLIPHQNLYW
Download sequence
Identical sequences ENSVPAP00000008321 ENSVPAP00000008321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]