SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009947 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009947
Domain Number 1 Region: 145-336
Classification Level Classification E-value
Superfamily E set domains 1.26e-51
Family Cytoplasmic domain of inward rectifier potassium channel 0.0003
Further Details:      
 
Domain Number 2 Region: 36-183
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.01e-24
Family Voltage-gated potassium channels 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009947   Gene: ENSVPAG00000010684   Transcript: ENSVPAT00000010684
Sequence length 360
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1515:201415:204238:-1 gene:ENSVPAG00000010684 transcript:ENSVPAT00000010684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGSNCKVIAPLLTQRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVF
SASFVVHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI
GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDLAVVAH
IEGKPNLIFQVANTRPSPLTSVRVSAILYQERENGKLYQTSVDFHLDGISSEECPFFIFP
LTYYHSIIPSSPLATLLQHENPPHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA
SLLTRGSKGEYQIKMENFDKTVPELPTPLVSKSPNRTDLDIHINGQSIDNFQISETGLTE
Download sequence
Identical sequences ENSVPAP00000009947 XP_006209184.1.17985 ENSVPAP00000009947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]