SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010116 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010116
Domain Number 1 Region: 709-816
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-38
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 291-401
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-31
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 3 Region: 840-933
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.33e-27
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 4 Region: 516-558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000301
Family EGF-type module 0.005
Further Details:      
 
Domain Number 5 Region: 662-702
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000547
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 6 Region: 555-598
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000981
Family Spermadhesin, CUB domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010116   Gene: ENSVPAG00000010865   Transcript: ENSVPAT00000010866
Sequence length 944
Comment pep:novel genescaffold:vicPac1:GeneScaffold_121:171245:296804:1 gene:ENSVPAG00000010865 transcript:ENSVPAT00000010866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFWGDIALDDEDLNIFQIDRTIDLTQNPFGKFGHTTGGFGDHGMSKKRGALYQLIERIRR
IGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXMFLDPILHSHADNGIHPAIGQQTCLSKGDTVQARKLCRCPACGETLQESNG
NLSSTGFSSGYSSYTYCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSP
LLGRFCGDRLPEVLTSTDSRMWIEFRSSSNWVGKGFAAAYEXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCVNTLGSYQ
CSCEPGYELGPDKRTCEAACGRLLMKLKGTIATPGCVWQMVAPTQYRVSMKSEFFELEGN
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHENKHDCKEAECEQKIHSPSGFITSPN
WPDKYPSRKECTWEISATPGHRVKLAFSEFEIEQHQECAYDHLEVFDGETEKSPILGRLC
GNKIPEPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLRAESKPRDLYSHAQFGDN
NYPGQADCEWLLASERGSRLELSFQIFEVEEEADCGYDYVELFDGLNSTAVGLGRFCGSG
PPEAIYSIGETVLIHFHTDDTISKKGFHIRYKSIRYPDTMHTKN
Download sequence
Identical sequences ENSVPAP00000010116 ENSVPAP00000010116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]