SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010362 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010362
Domain Number 1 Region: 1122-1296
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.3e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.00059
Further Details:      
 
Domain Number 2 Region: 686-801
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.09e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0014
Further Details:      
 
Domain Number 3 Region: 449-574
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-25
Family Pleckstrin-homology domain (PH domain) 0.0000134
Further Details:      
 
Domain Number 4 Region: 883-1034
Classification Level Classification E-value
Superfamily PH domain-like 1.92e-21
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 5 Region: 1431-1566
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-20
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 6 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.24e-16
Family SAM (sterile alpha motif) domain 0.0000427
Further Details:      
 
Domain Number 7 Region: 584-685
Classification Level Classification E-value
Superfamily PH domain-like 9.31e-16
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 8 Region: 1019-1111
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000777
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010362   Gene: ENSVPAG00000011122   Transcript: ENSVPAT00000011126
Sequence length 1701
Comment pep:novel genescaffold:vicPac1:GeneScaffold_144:360809:526737:-1 gene:ENSVPAG00000011122 transcript:ENSVPAT00000011126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVSEVNVDIKDFLMSINLEQYLLHFREFGFNNVKDCAAINDSVLLKVGISPTGHRRRI
LKQLQIVLSKMQDIPVYANVHKTKKNDETPKDHPAPSSDQNTCIELSDSPSVQTPSPVQL
ETVTNNLDPDEATVGNSQPLKSEDKLTLPKHNFPIPEEXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXYFRERRNVATSTGKSVTQQNSNEENSSFILPYGETFLFQRLENSKKKSIRNEFWTHEE
TLKRETTTERNSFFVKSSIYDNRTENISEDKVEDIWIPREDKSKLPVDSASESDYSTVEE
CFQSLRRKNSKPSKSRTQKASNLDPVNRHSYPLSSTSGNTDSSIISSNVISPYACFYGSS
ARKVKSGWLDKLCPQGKRMFQKRWVKFDGLSISYYNNDKEKYSKGIIPLSAISTVRVQGD
NKFEVVTTQRTFVFRVEKEEERNDWISLLLNALKLQSLSSQSPAVAAPEKCGYLELRGYK
AKIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFT
AESEKEKQEWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVIC
KKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMD
SPVEKRKTFITQKYKEGRFRKTFLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMC
ATGDPEYSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGGLNQESSQSTFLCDFLY
QAPAAASKLSSEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTININEVICLAVHKED
FCLNTGPIFTFEIYLPSERAFLFGAETSQAQRKWTEAIAKHFIPFVAENLTETDYGLIGQ
LYYKDCHALDQWRKGWFALDKSSLRFCLQEGQEDRMHLRRLQELTISTVVQNGEKMDVLL
LVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGRALQDQQLSKNDVPIIVNSCIAFVTQY
GLGCKYIYQKNGDPLHVSELLESFKKDARSFKLRAGKHQLEDVTGVLKSFLSDIDDALLT
KELYPYWISALDIQDDKERIKKYGAFIRTLPGVNQATLAAVIEHLYRVQKCSEINHMDAH
NLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFECLEYQGIPSDIDNSYTMWIDHVSQ
AGDLLIEVYVERKEPDCSIIIRISPVMEAEELTSDILAIKNIIPTKDDLWATFEVIENEE
LERPLHYTENVLEQVLRWSSLAEPGSAYLVVKRFFTIDTIKQYNERKGLGSIKEGFLKIK
EEPSKILSGNKFQDRYFVLRDGYLFLYKDPKSSKPDKMFSLSSMKFYLGVKKKMKPPTSW
GLTAYSEKHHWHLCCDSSQTQMEWMTNVFIAQHENDIWPPAGKERKRSITKNPKIGGLPL
IPIQHERNATQARRNIESARAELERLRLGAKCVQEPGDSTLKGRASLVAQCLEHKDDKLR
SRTRKHRSFNCLEDTEAEVLQGQPKGHRGLKTLRKTEDRNGKATLDTNNKLPSKVIEELS
VVLQRSRALPKELQGEQVVQK
Download sequence
Identical sequences ENSVPAP00000010362 ENSVPAP00000010362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]