SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|431807884|ref|YP_007234782.1| from Brachyspira pilosicoli P43/6/78

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431807884|ref|YP_007234782.1|
Domain Number 1 Region: 11-146
Classification Level Classification E-value
Superfamily CheY-like 4.98e-25
Family CheY-related 0.0016
Further Details:      
 
Domain Number 2 Region: 179-385
Classification Level Classification E-value
Superfamily PP2C-like 0.000000955
Family PP2C-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|431807884|ref|YP_007234782.1|
Sequence length 388
Comment response regulator receiver modulated serine phosphatase [Brachyspira pilosicoli P43/6/78]
Sequence
MASTRNNILTEKVLIVDTNIDYAKFIQKFLKKNNYLCYIALSYEEAINMTYEKIPDCILV
DYMLPNAGACRLAGYIKSDNLLKNIAVLFLTASDNKTESLKAFDCGADGFFEKSIDTDLF
LSKMKSYIRLKKAIESNMMYMDILKRDIEYAAKLQKTILSYGNTSIPKNEISIHHYAPNE
VSGDYSGIKLINDGYYAILLADVSGHGVAASMLTILIKSFFDSHAIIDDKNTSPAIFLEK
LNKFFIEEGFDKNLFACVFYALYNNDTGALLCSSAGSPKPIYYSNGKDEICTVDIDGPLI
GMIDDSEYTEMEIQLNRNDILFVFTDGAYEVFDDNNNMFGDEHLKQIFSKNVKNNVSDIK
EKIINEIKSFTKEPLKDDVSMILLKRTT
Download sequence
Identical sequences J9UXI8 K0JGT3
gi|404476915|ref|YP_006708346.1| WP_014932491.1.48933 WP_014932491.1.67631 WP_014932491.1.92922 gi|434381359|ref|YP_006703142.1| gi|431807884|ref|YP_007234782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]