SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000003571 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000003571
Domain Number 1 Region: 721-778
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.25e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 2 Region: 28-69
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000785
Family Somatomedin B domain 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000003571
Domain Number - Region: 64-135
Classification Level Classification E-value
Superfamily E set domains 0.00224
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000003571   Gene: ENSPCAG00000003777   Transcript: ENSPCAT00000003805
Sequence length 817
Comment pep:novel genescaffold:proCap1:GeneScaffold_1140:152920:159653:1 gene:ENSPCAG00000003777 transcript:ENSPCAT00000003805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLAFTSWALLLLMLAPDLEPQPVSGAQESCAQRCGDKSGPCSCHPTCSNLGSCCLDMQD
FCLDILPYSGSIMGGKDFVVKHLRSGPTSGVVCRFKGSVQTRGRVDDSQQVHCVSPLIYE
SGLIPFMLSLDDGHTFERSGTWLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXKPYSEEWTAKWSYLYTLATNVSNSGTFTFTPKPAPHNYQ
QWEVGALRILDSTHQAGARDVQSLWSNEHALAWHLGDDFQADPVAWARTRCLAWEELEDQ
LPDFLGELPDCPCTLVQARADSGRFFTDYGCDIEQGSVCTYHPEAVHCVRSVQASPRYAS
GQQCCYTKNGTQLLTADSTSGSTPDRGHDWGAPPFLVPPRVPGLSHWLYDVISYYHCCLW
ARECHRYMRRRPSSGCRNYQPPHLASAFGDPHFLTFDGANFTFNGHGEYVLLEAGLTQLS
VQARAQPGMMPNGTQALGTGLTAVAVQEGTSDVLEVRLADGTRTLQVLLNQRVLSFDEQR
WMDLNGMFLSVASEQHVSIMLSSGAGLEVSTQGPSLSVTILLPEKFRNHTQGLLGTLNDN
PDDDFTLPSGHILPANASTRQLFGFGANWAVQNESSLFTYDSHFLVNNYLLQPKHDPSFL
PLFPDEDTGYSHLVHQANAFCGDDPFCSFDVVATGNLSVGNATRAAHELHQHRMQSLQPV
VSCGWVSPPTNGRKEGTTYLVGSTVHFSCDSGYSLDGEKAITCQANGTWSMPTPKCQPGR
SYPVLLSIIFGGLAVVLLVTLLYVLLSRRKGHRDILQ
Download sequence
Identical sequences ENSPCAP00000003571 ENSPCAP00000003571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]