SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000006643 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000006643
Domain Number 1 Region: 159-373
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.46e-63
Family Phosphonoacetate hydrolase 0.033
Further Details:      
 
Domain Number 2 Region: 432-525
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 5.89e-17
Family DeoB catalytic domain-like 0.058
Further Details:      
 
Domain Number 3 Region: 659-756
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0000000188
Family DNA/RNA non-specific endonuclease 0.017
Further Details:      
 
Domain Number 4 Region: 52-93
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000353
Family Somatomedin B domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000006643   Gene: ENSPCAG00000007043   Transcript: ENSPCAT00000007102
Sequence length 875
Comment pep:novel genescaffold:proCap1:GeneScaffold_1967:85373:174046:1 gene:ENSPCAG00000007043 transcript:ENSPCAT00000007102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFMAILSMGKPVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSCRRKCFD
ASFRGLEGCRCDVGCNDRGDCCWDFEDTCVESXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDLPPVILFSMDGFRAEYLQTWHTL
MPNVNKLKTCGIHSKYLRAVYPTKTFPNHYTIVTGLYPESHGIIDNNMYDVNLNRSFSLS
SMEKEDPAWWGGQPIWLTAMYQGLKAGTYFWPGSDVAINGTFPSKYMLYKNSVPFEERIF
TVLKWLDLPQTERPNFYTLYLEEPDTAGHRGGPVSANVVQALQLVDQAFGMLMEGLKQRN
LHNCVNIILLADHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXCQKSDQHFKPYLTPDLPKRLHYAKNVRIDKVHLVMDQQWLGVSSKAFTSCGG
GNHGFDNKFKSMEAVFMAHGPSFQEKIEVEPFENIEVYNLMCDLLHIQPAPNNGTHGSLN
HLLKTPFHKPSHPEEVSKSSPCGFTNPLPTDSLECSCPELQNQTLLEHVNQRLNLTSEEX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDTSPLPPP
VPDCLRADVRVAPSESQKCSFYLADENITHGFLYPPANNRTSDGQYDALITSNLVPMYEE
FKKIWNYFHNVLLVIYAVERNGVNVISGPIFDYNYDGHFDAPDEITXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGKSEAVWIEERWNAHIARVR
DVELLTGLDFYQEKAQPVSEILQLKTYLPILETLV
Download sequence
Identical sequences ENSPCAP00000006643 ENSPCAP00000006643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]