SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013414 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013414
Domain Number 1 Region: 151-277,323-454
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 4.64e-53
Family Phosphonoacetate hydrolase 0.01
Further Details:      
 
Domain Number 2 Region: 644-851
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0000000000000647
Family DNA/RNA non-specific endonuclease 0.018
Further Details:      
 
Domain Number 3 Region: 513-570
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.000000000388
Family Arylsulfatase 0.055
Further Details:      
 
Domain Number 4 Region: 57-103
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000641
Family Somatomedin B domain 0.0015
Further Details:      
 
Domain Number 5 Region: 105-146
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000405
Family Somatomedin B domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013414   Gene: ENSPCAG00000014294   Transcript: ENSPCAT00000014354
Sequence length 855
Comment pep:novel genescaffold:proCap1:GeneScaffold_3429:5761:92939:-1 gene:ENSPCAG00000014294 transcript:ENSPCAT00000014354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRSSGPSPQVISLFTFAIGVNICLGYTLNRAKRAEGWDEGPPTELSDSPWISTSGSCK
GRCYELQELEPPDCRCDNLCKSYSSCCHDFDEHCLKTARGWECTKDRCGEARNEDNACHC
SEDCMARGDCCTNYHVVCKGESHWVDDECEEIKTPECPVGFVRPPLIIFSVDGFRASYMK
KGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDA
TFHLRGREKFNHRWWGGQPLWITAIKQGVKAGTFFWPIAISHERRILTILHWLTLPDDEX
XXXXXXXXXXXXXXXXXXXXXXXXESSFGSALTPAKRPKRKVAPKRRQERPVAPPKKRRR
KLHRMDQYAAEARQDKMTNPLREIDKIMGQLMDGLKQLQLHRCVNVIFVGDHGMEDVTCD
RTEFLSNYLTNVDDIILLPGSLGRIRSKFSNNPKXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXKPMDVYKKPSGKCFFQGDHGFDNKLNSMQTVF
VGYGPTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTHTFRPTMPEEV
TRPNYPGVGYLASDFDLRCSCDDVAPTSKLDELNKRLNTKSTERHLLYGRPAVLYRTRYD
ILSHIDFESGYSEIFLMPLWTSYTVSKQAEVSVIPEHLTSCVRPDVRVSSFSQNCLAYKN
DKQMSYGFLFPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVWNYFQRVLVKKYASERNGVN
VISGPIFDYDYDGLHDTPDKIKQYVEGSSIPVPTHYYSIVTSCLDFTQPADKCDGPLSVS
SFVLPHRPDNEESCN
Download sequence
Identical sequences ENSPCAP00000013414 ENSPCAP00000013414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]