SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000000368 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000000368
Domain Number 1 Region: 58-174,200-250
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.29e-17
Family Nucleotide and nucleoside kinases 0.006
Further Details:      
 
Domain Number 2 Region: 268-466
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.82e-16
Family Nucleotide and nucleoside kinases 0.012
Further Details:      
 
Domain Number 3 Region: 177-205
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0000000837
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000000368   Gene: ENSPCAG00000000385   Transcript: ENSPCAT00000000395
Sequence length 474
Comment pep:novel genescaffold:proCap1:GeneScaffold_5431:7076:112628:-1 gene:ENSPCAG00000000385 transcript:ENSPCAT00000000395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDATTASHHIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKI
VILGPPASGKTTIAMWLCKHLNSSLLTAETLMRKEYSPLAAEAVRLYQKSKXXXXXXXXX
XXXXXXXXXXXXXXGWILDGIPETREQALMIQSLGITPRHVIVLSAPDTVLIERNVGKRI
DPLTGEIYHTTFDWPPESDVQNRLITPEGISEMETAQKLLEYHRNIVRIMPSYPKILKVI
SSDQPCVDVFYQALTYVQTNHRSNAPFTPRVLICGPVGSGKSLQAALLAQKYGLVNVCCG
QLLKETVADKSRLGELIRPYFEKKMAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXNLTYVFFLNVPFDSVIERLTLRRIDPVTGERYHLMYKPPPTMEIQSRLLQNPKDA
EDQVKLKMDLFYRNSAELEQYYQYAITINGDQDPYTVFEYIESGIINPLPRKIP
Download sequence
Identical sequences ENSPCAP00000000368 ENSPCAP00000000368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]